PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr005254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 554aa    MW: 62368.7 Da    PI: 6.2314
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr005254.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.31e-1361775471374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+++L+ cA+av+++dl +aq+++ +l++++s +g+p+qRl ay++e+L ar a+s+s++ykal+++e +   s e l+++++++ev+P++kf+++ a
  Pbr005254.1 177 LKQVLIFCAKAVADNDLLMAQWMMDELRQMVSVSGEPIQRLGAYLLEGLVARKASSGSNIYKALRCKEPA---SCELLSYMHILYEVCPYFKFGYMSA 271
                  5799*****************************************************************9...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea++ e+ vHiiDf+i+qG QW++L+qa+asRp+gpp++RiTg++++ s   +    + +g+rL+k+Ae ++vpfef++ ++ +  d++le+L
  Pbr005254.1 272 NGAIAEAMKDEDSVHIIDFQIGQGSQWVTLIQAFASRPGGPPHIRITGIDDSMSAyaRGGGPNIVGKRLSKLAELFKVPFEFHA-ASMSGCDVQLEHL 368
                  ***************************************************88878888999**********************.8999********* PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                   v+pgEala+n++++lh+++desv+++++rd++L+lvkslsPkvv++veqe+++n++ F  rf+e+l+yy+a+f+s++++lpr+++eri+vE+++l+r
  Pbr005254.1 369 CVRPGEALAINFAFMLHHMPDESVCTQNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFYPRFVETLNYYTAMFESIDVTLPRDHKERINVEQHCLAR 466
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  e+vn++aceg er+erhe l+kWr r+ +aGF+p+pls+ +++++k+ll ++++  yr+ee++g+l+lgWk+r Lv+ +aWr
  Pbr005254.1 467 EVVNIIACEGVERVERHELLGKWRLRFAMAGFTPYPLSSLVNATIKTLLDNYSD-KYRLEERDGALYLGWKNRDLVASCAWR 547
                  *****************************************************5.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.493151528IPR005202Transcription factor GRAS
PfamPF035143.5E-134177547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MQASKEQRIS GMSNRLYCQP VQEVEAYCLP RFQTLEPRLH YNESSQSTHL PLQSFHEHYC  60
TLESSWSNGS YNVYNTPSNV SFSPSGSPMS QQDSHSYLSD QYHSPDQTYS SSISGSCITD  120
DATDFKYKLK QLETVMLGPD SNILDNYCIT FPNGASNSLP DEDSWGQIME SISKKDLKQV  180
LIFCAKAVAD NDLLMAQWMM DELRQMVSVS GEPIQRLGAY LLEGLVARKA SSGSNIYKAL  240
RCKEPASCEL LSYMHILYEV CPYFKFGYMS ANGAIAEAMK DEDSVHIIDF QIGQGSQWVT  300
LIQAFASRPG GPPHIRITGI DDSMSAYARG GGPNIVGKRL SKLAELFKVP FEFHAASMSG  360
CDVQLEHLCV RPGEALAINF AFMLHHMPDE SVCTQNHRDR LLRLVKSLSP KVVTLVEQES  420
NTNTAAFYPR FVETLNYYTA MFESIDVTLP RDHKERINVE QHCLAREVVN IIACEGVERV  480
ERHELLGKWR LRFAMAGFTP YPLSSLVNAT IKTLLDNYSD KYRLEERDGA LYLGWKNRDL  540
VASCAWRCKH STN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-621795476375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009365203.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLD9ZJB70.0D9ZJB7_MALDO; SCL domain class transcription factor
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein